GLP-2-GLP-3 Blend
Reviewed by Alex X. Smith
GLP-2 / GLP-3 Research Blend: Notes on Multi-Receptor Incretin Combinations
Research summary. "GLP-2 / GLP-3 Blend" is a research-context naming convention that tends to appear in the research-peptide market more than in the formal scientific literature. The terminology is not standardised: GLP-2 has a precise scientific meaning (the 33-amino-acid intestinotrophic peptide encoded alongside GLP-1 in the proglucagon gene), while "GLP-3" is informal and most often refers in supplier contexts to a glucagon-receptor-engaging GLP-1/glucagon dual agonist or to a triple-agonist research molecule. This post addresses both genuine GLP-2 biology and the broader context of multi-receptor incretin combinations.
Note on terminology
Researchers should be aware that "GLP-3" is not a recognised endogenous peptide. The proglucagon gene encodes glucagon, GLP-1, and GLP-2 — and additional fragments such as glicentin and oxyntomodulin — but no peptide referred to formally as GLP-3 in the canonical biology. When this term appears in research-peptide product literature, it most commonly refers to:
- A GLP-1/glucagon dual agonist in development (such as cotadutide, survodutide, or pemvidutide)
- A GLP-1/GIP/glucagon triple agonist (such as retatrutide)
- A custom research blend containing GLP-1- and glucagon-receptor-engaging components
Researchers using a "GLP-3" labelled material should request explicit identification of the molecules included in the blend.
GLP-2: Molecular profile and biology
GLP-2 is the more rigorously defined component of this naming convention.
- Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (human GLP-2 1–33)
- Length: 33 amino acids
- Origin: Encoded by the proglucagon gene; secreted from intestinal L-cells alongside GLP-1
- Receptor: GLP-2 receptor (GLP-2R), a class B GPCR
GLP-2 mechanism of action
GLP-2 binds GLP-2R, which is expressed primarily in enteric neurons, subepithelial myofibroblasts, and selected enteroendocrine cells. Receptor activation produces:
- Increased intestinal villus height and crypt depth
- Enhanced epithelial cell proliferation
- Reduced epithelial apoptosis
- Increased intestinal blood flow
- Modulation of nutrient absorption capacity
These collective effects make GLP-2 an intestinotrophic peptide — that is, a peptide that supports growth and functional capacity of the small-intestine epithelium.
GLP-2 clinical context
The clinically validated GLP-2 analogue is teduglutide (Gattex/Revestive), an FDA-approved peptide for short bowel syndrome. Teduglutide is a 33-amino-acid analogue with a single amino-acid substitution (Gly-Gly substitution at position 2) that resists DPP-IV cleavage, extending the half-life from approximately 7 minutes (native GLP-2) to approximately 2 hours.
Teduglutide is approved for:
- Adult and pediatric patients with short bowel syndrome dependent on parenteral nutrition
The therapeutic logic is direct: GLP-2R agonism promotes intestinal villus growth, supporting nutrient absorption and reducing parenteral nutrition requirements.
Multi-receptor incretin combinations
The broader concept underlying the "blend" naming convention is mechanistically grounded. The proglucagon-derived peptides — glucagon, GLP-1, GLP-2 — act on distinct receptors with complementary metabolic activities:
- GLP-1R agonism: Glucose-dependent insulin secretion, satiety, gastric emptying suppression
- GIP-R agonism (incretin pathway): Synergistic insulin release, adipose-specific effects
- Glucagon-receptor agonism: Increased energy expenditure through hepatic and adipose-tissue effects
- GLP-2R agonism: Intestinotrophic activity, indirect metabolic effects via gut barrier function
The class of multi-target unimolecular peptide agonists has progressed substantially:
- Tirzepatide: GIP/GLP-1 dual agonist (FDA-approved as Mounjaro/Zepbound)
- Cotadutide, survodutide, pemvidutide: GLP-1/glucagon dual agonists (in development)
- Retatrutide: GIP/GLP-1/glucagon triple agonist (Phase 3)
GLP-2 has been explored as a fourth axis in some preclinical research programmes, but no GLP-2-incorporating multi-receptor agonist has progressed into late-stage clinical development.
Practical research considerations
If a research-peptide preparation labelled "GLP-2 / GLP-3 Blend" is being used in research, the following should be clarified before experimental design:
- The exact molecular identity of each component
- Whether the "GLP-2" component is native human GLP-2 or a stabilised analogue (e.g., teduglutide)
- The molecular identity of the "GLP-3" component, since the term has no formal scientific meaning
- The molar ratio of the components in the blend
- The mechanism of separation, if any, after administration
In most practical contexts, formal multi-receptor agonist development uses unimolecular molecules (single peptides engineered to engage multiple receptors) rather than blends, because the pharmacokinetics of mixed molecules are more difficult to control.
Current research status
GLP-2 itself is endogenous and is the subject of active mainstream pharmacological research, particularly in the context of teduglutide and short bowel syndrome. Multi-receptor agonist research is one of the most active areas in metabolic peptide therapeutics, with several molecules in late-stage development. "GLP-2 / GLP-3 Blend" preparations specifically are research-grade research-supply materials and are not approved therapeutics.
Key takeaways for researchers
- GLP-2 is a defined 33-amino-acid intestinotrophic peptide encoded by the proglucagon gene.
- "GLP-3" is not a recognised endogenous peptide; the term in research-peptide contexts typically refers to a glucagon-receptor-engaging multi-agonist or research blend.
- Teduglutide is the FDA-approved GLP-2 analogue for short bowel syndrome.
- Multi-receptor agonist research is a major active area, with established molecules including tirzepatide and emerging molecules including retatrutide and survodutide.
- Researchers using "blend" preparations should clarify exact molecular composition before experimental work.
References
- Drucker DJ, Erlich P, Asa SL, Brubaker PL. Induction of intestinal epithelial proliferation by glucagon-like peptide 2. Proceedings of the National Academy of Sciences USA. 1996;93(15):7911–7916.
This article is provided for educational and research purposes only. The peptides discussed here are research molecules. With the exception of FDA-approved teduglutide for short bowel syndrome, none of the components typically included in "GLP-2 / GLP-3 Blend" preparations are approved drugs or therapeutic agents, and they are not intended for human consumption, diagnosis, treatment, cure, or prevention of any disease or condition. All research work involving these peptides should be conducted by qualified personnel within an appropriate research setting and in compliance with applicable institutional and regulatory requirements.